PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606534.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 751aa    MW: 82411.8 Da    PI: 6.4594
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606534.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.82.4e-2056111156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F++n++p++++r eL k+l L+ rqVk+WFqNrR+++k
  XP_009606534.1  56 KKKYHRHTPYQIQELEAAFKENPHPDEKARLELGKRLTLESRQVKFWFQNRRTQMK 111
                     79999************************************************999 PP

2START163.31.8e-512644881206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el+k+a+ ++p+W++      e +n +e+ ++f++  +     +++ea +a+g v  ++  lve+l+d++ +W e++     + +t+
  XP_009606534.1 264 ELAFAAMNELLKLAEIGDPLWFRNFdgsgEALNLEEYARSFPPCIGmkpsnFTTEATKATGTVMINSLVLVETLMDTS-RWVEMFScivgRTSTI 357
                     57899******************9999999*************99999**9***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +viss       g lql++ae+q+ls lv  R + f+R+++q+ +g+w++vdvS+d  q+ ++  +   +++lpSg+++++++ng+skv+w+eh+
  XP_009606534.1 358 DVISSSasgsrnGNLQLIQAEFQVLSALVFvRQVKFLRFCKQHAEGVWAVVDVSIDTIQEGSQPREAGNCRRLPSGCIVQDLPNGYSKVIWIEHM 452
                     *****999*****************************************************998899999************************* PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++h+l+r++++sg+ +ga++w atlqrqce+
  XP_009606534.1 453 EYDENTIHNLYRPFIRSGRGFGAQRWIATLQRQCEC 488
                     **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-2230115IPR009057Homeodomain-like
SuperFamilySSF466895.56E-2039113IPR009057Homeodomain-like
PROSITE profilePS5007117.73453113IPR001356Homeobox domain
SMARTSM003892.5E-1655117IPR001356Homeobox domain
CDDcd000861.28E-1756113No hitNo description
PfamPF000465.9E-1856111IPR001356Homeobox domain
PROSITE profilePS5084838.472255491IPR002913START domain
SuperFamilySSF559613.16E-28256488No hitNo description
CDDcd088754.02E-110259487No hitNo description
SMARTSM002342.5E-35264488IPR002913START domain
PfamPF018521.3E-44264488IPR002913START domain
SuperFamilySSF559614.12E-13534744No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MEGLGDMGMI GENFDAVAMG RSSREDEYES RSGSDNLDGG ASGDDLDAPL GKSSRKKKYH  60
RHTPYQIQEL EAAFKENPHP DEKARLELGK RLTLESRQVK FWFQNRRTQM KTQLERHENA  120
LLKQEYDKLR IENIAMKEAM RSPMCGHCGG QAILGEIHIE EHHLRIENAR LRDELNRICV  180
LANKFLGRPL GSFPGAMPPG MANSGLELAV GRNGFGAMNS ADTALPMGLD FGNGLSSPLT  240
MMSPRPTPSM SSTDVSFDKS MLMELAFAAM NELLKLAEIG DPLWFRNFDG SGEALNLEEY  300
ARSFPPCIGM KPSNFTTEAT KATGTVMINS LVLVETLMDT SRWVEMFSCI VGRTSTIDVI  360
SSSASGSRNG NLQLIQAEFQ VLSALVFVRQ VKFLRFCKQH AEGVWAVVDV SIDTIQEGSQ  420
PREAGNCRRL PSGCIVQDLP NGYSKVIWIE HMEYDENTIH NLYRPFIRSG RGFGAQRWIA  480
TLQRQCECLA VITSSAVPSG DSAAVISPSG RRSIAMLARR ITRNFCGGVC ATFYKWEPIQ  540
TGTAEDTKLM MRKSIGDPGE PPGIVLSATR TIWLPVTHQR LFDFLRNEQT RSQWDVLSHG  600
GPMHQIVHIA KGQDLGNSIS LFRANAASRD ANQNSMLILQ DSCTDVSGSI VAYAAVDTAE  660
MNVVMSGGDS SCVAFLPSGF AIVPDCFQNS NNGMLEKEDN GGSSNGSLLT LGFQILVNSL  720
PAAKLTMESV NTVNALISRT LQGIKTAFQC N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606532.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM1B4R10.0M1B4R1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000370550.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein